SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4SQV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4SQV0
Domain Number 1 Region: 2469-2844
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.49e-67
Family Hect, E3 ligase catalytic domain 0.00017
Further Details:      
 
Weak hits

Sequence:  A0A2B4SQV0
Domain Number - Region: 512-594
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000249
Family beta-lactamase inhibitor protein-II, BLIP-II 0.076
Further Details:      
 
Domain Number - Region: 1284-1323,1391-1421
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0129
Family Canonical RBD 0.021
Further Details:      
 
Domain Number - Region: 1112-1165,1218-1252
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2B4SQV0
Sequence length 2851
Comment (tr|A0A2B4SQV0|A0A2B4SQV0_STYPI) E3 ubiquitin-protein ligase UBR5 {ECO:0000313|EMBL:PFX30867.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene4323 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MKPKSMADRYHELDARTNLSPRIIFVRLGKDKSKDTVEDEIFKYIKKVLNESTVGNSDLE
KAKSCVTLPDFGTGKIVQVAVGPAFIGFLFHDGRVCRMKCVSRNSESTQTLNNSQDYSEE
PIFQVKSDEVYAKQLQNQLNEEIRTKRTSPGRSLVHGGATSSLNLSFRASDGYDSGDVLL
SDRTRQSVVKPWSAKAGPSSSADDGTTQVNQETQTGREDLQQTNNTPGNGGSSSHETNKD
KSKQSCNTDENVNPDESCTVGDDSVTSDFTNQENKETAGTSKPNVQDKCSQEVENSSGNV
SINNSSSGASSRSSNSRRSVSRPTFLHRTLYAANLPGVVRPWPPYGIPVVGSVQQFPPYI
SRGNRTSGRSSVPLQAHVVRAHLAEQLAGAYVFSRGPRGPRRTNFQRKDERATGENSETT
SCSDADFCYPEIGDLEWLEVENGQEVAFSHITAMHSEFVLVEKGTGILYHWPYESDVACD
VAMEISSSLEPSYFPLAKPHPLGEALGLDSEEVCLLASSNVRCSLVTSSGKICTFYDKLL
RESNCGDPPALVQELSHSARAFAELQGEEIVSISCSEFFSGLMTQSGKIFWWGLLPAEER
QNFRQKLSKATNQSSNIGVNEKVQLRQHFPGFPGALVYKYCEVRGPIVGRLIGHESPEGT
STVVTKIKVEPLYKRSASSDKPESGIVQTDIDISAANSSRAKTVEEEFISSQKDFARSSS
PHTSVRRKAQFSHVSSNGSEIWEVKDVVFLESENKLLGTVAAIDGPHVIVKVANVMSPSE
SSLRVFKLSELEPVPSEGAEGSTLTRSLSTSSLYRGCIQHAPKCVVSSSPRSVGKDVLSG
FRPVAMTATSTGISLIVQRLSDKKAFFMGPAMEQVVDSSKVYTCSGDVNVTSSIDDGSCT
VEAEAIQSQEGALEPVSLVPSDTSPKPIIGLKRRRRSDENDDDVDSDTLHSTQTTPNIES
SILNRLLPCNFHSANQKFPLLHSSSDYDIVLLTDVNGCLCPRPFGTKLSSPNVGDIPPVQ
SFGLGTRLGHSSAENSSPERVLIAFIAFQEQHLIQAVQSGVVERIQEALNFLKQLNNSKD
IGKVNKSMVKGSKKVAIADTNGQVHGEPAGQTIVINKRVLQLLHQHTTSNQNLLHICCSN
PTFTENRDWFNNILKKCSKGTEATLPTEGDSESREEMPEDVKGSESREELPTEVRGLHIL
LNDSVFAKEFVPMLRGRDACGNTPFMTAIQCHNFKAAVYILDFVEKNKENCSLKEMIFPG
VFNGMTPLHALAVACTENLSPSGLGNSLTVTNLPSSYTPRILLKLFQSRYPSVYRATIPP
MDMEGRKVCRAKFPKYKVTEKFFAMQAKNSHKKKPTEAKKGNLLTPPTSGGNGNPWSRRY
VEGGGRIPVVSSRRESLTGVVTFSDPKELRQALVEMDHHMVSTEMSAPEGGLASLVQHVL
HVKLTEVENEASEKNEMEVGVRGGVYNVSNVDGVPKISPKSQSATSVKPSQKEGEDRLIC
QLVCRLLPYPEIATATNREGETALAFLVNNSRWIKLSVSQKQRLTKYGSMLFGQDVAFPV
KREQATQQDVSRSPQEGDIMTEINITGVSDTTMLETNLLAQLDDISSSFRSIVDTLQALE
RRCQLPEQPQEQTQNPQTGDEKDKEKLPGNESTSGENETPMDVASENAAESIDLIGFPPS
TSVVPDDLPGESLPVLIQLIQSWPSVVSTVLGYYPFGTSSVHSDVHMTKEPRGSGDLPRK
GPSRCSPVDSCIMDVFVFELLSHSDEAVLMTFVEMIVDEMNKHSQNLTLDAVHRIAQLQG
DPSAADVAMMVGMKFLRSVIRQLAVHLSRSGLSYVDLRTRLGSSPSTSTSRSSQGDNVQF
KKKVRMILRSFSWLAVHELTQAAEASVLPVREGVAKPQARSTGSSVSNNVPNPNGFPGAR
FRFRPGIRVGPHDLSARPQDPPLRTAQRISQTNITENSSACRGIRLADISEGPSGIANKK
HAPSPLRASPFEVSRVHGKKNSLVDSDSDSADETDHVGALSGDGDSDMELDERDQRSVSV
TTGITHDHPYAWALDGRVASLIEGNNLPGHIHIPQWAAPVVSPPSVHTGNCYLTRMFSRL
VKETLVLMTTLTKDTYSTQQGSAMLPSLTITQQERQSVQNHVMSVLERSWLWLAGVLDVV
EGQLRMGKDFDTKRYLASLRRPEDAEQALLGRSMSTIPGASPEEYLMFLLRAHNNEHKDS
LPVVDMLCYEHTVYVLDAFIYSMTHWPRLASTLDRRISMTSNDGDDSSPSFSQPSQPEDG
PLGLETKSSPNTESKRWRRHSHEREAIIKFFGMDVMHGDREKFLTSLQDTIQQKFPKVPK
ASWEVFAHNVTLARQKSEDPNLTSQKESEEESGLPTTFSAMGSHTYPSPLVTNWSPDQVI
SRWKISVDLFSRLFLADGPGAERESFLAARAGVAGRLARFRRAASYLRESISSESQQMGS
YGGLGARVSTTLTLTIKRQKIQENTLRILGEMSTCHYSNLRVKFEGEEGSGPGVNRGFFA
AMANALKTDEKLPVETTTLLHEPGKLPEQSGFYAPKPFAYSDKSPEENNIKNRRLKMFTA
IGRFIGLSLWFSVTVPLNFSRHVVKFLLERDVTWEDLAFFNADLFEGLSSMILDTTHPLM
TSERFQATYCCHFETSVGGTTEELIPGGSQIPVTPDNIFKYVRLYATKVMIGCVENELRA
MRSGLNDVIPSELLTSLTPEDFQLLLSGGTTDVDINRLRSVMTFSNSNGCSTDILDRFKR
WFWSIVQKMTPLQRQQLLYFCTGSAVLPAPSDRRDPEQELNITVDVISGNTKALPMATTC
GQRMSIPLYPSKKILKRKLFQAIQCQGYGLG
Download sequence
Identical sequences A0A2B4SQV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]