SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B5Q0E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2B5Q0E9
Domain Number - Region: 7-64
Classification Level Classification E-value
Superfamily IpaD-like 0.00628
Family IpaD-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2B5Q0E9
Sequence length 121
Comment (tr|A0A2B5Q0E9|A0A2B5Q0E9_BACMY) Uncharacterized protein {ECO:0000313|EMBL:PGA03618.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=COL71_29080 OC=Bacillus cereus group.
Sequence
MFDKLKDTVENNVEAMDQLYEKFIRQIENTPIIGQYHNYKKGQNEAVLDELKGILNTILH
PIDSVEGEVKIPLPFIDDWKLVVGGDVAYGSIGGEAKVGLKSELSVGLGPVGLGIKFGVE
K
Download sequence
Identical sequences A0A2B5Q0E9
WP_002125618.1.4354 WP_002125618.1.75292 WP_002125618.1.85187 WP_002125618.1.87416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]