SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B7DJS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B7DJS9
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily BH3703-like 0.00000981
Family BH3703-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2B7DJS9
Sequence length 151
Comment (tr|A0A2B7DJS9|A0A2B7DJS9_9BACI) DUF600 domain-containing protein {ECO:0000313|EMBL:PGE75969.1} KW=Complete proteome OX=64104 OS=Bacillus pseudomycoides. GN=COM55_27805 OC=Bacillus cereus group.
Sequence
MKEFEDKFSELQSDMIAICMEFVEDRADKVYVYASCEEGIISGRFFYLINNKYVKPHKVN
DALENGDERYDVSPKRGFTVLRIICEDIKKIKELCKEYERDIPTEMKLIYDVKSGNFKAG
YKYDLVYTNDDIKTADHIADEWFEEVKNNNL
Download sequence
Identical sequences A0A1S8G4N0 A0A2B7DJS9 R8PAL7 R8QV14 R8TWF8
WP_016114228.1.24079 WP_016114228.1.75903 WP_016114228.1.936 WP_016114228.1.94911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]