SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B7Y0T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B7Y0T1
Domain Number 1 Region: 144-238
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000000000353
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00054
Further Details:      
 
Domain Number 2 Region: 469-579
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000235
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2B7Y0T1
Sequence length 664
Comment (tr|A0A2B7Y0T1|A0A2B7Y0T1_9EURO) Uncharacterized protein {ECO:0000313|EMBL:PGH14327.1} KW=Complete proteome; Reference proteome OX=1447875 OS=Helicocarpus griseus UAMH5409. GN=AJ79_03149 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Helicocarpus.
Sequence
MAVDIKTRVLSHDSKVETPNDSVTRMPGVALEDRVVEMDAGGGQHVYGNKKGLVVGQKEV
DDEGNNWLSSVNLTYNNKYRRRVLMSATASFSEVAIPLIAQMPDIELRLISDDALSLTIG
AGKAAVYVDTPTPGQLGSKLSSRPWMNMTATELIDWADVLILGAMDAGTLGAMLAGLTTT
LTLTVLRGWDVSKPVLLIPGMTTAEWQFPLTKRQFTELATSWPWVRVLQPILSKLESAKN
LVEIPWDEWAAFGNEVRKCLGRPFTPSCIQGDEKHINNVYNGNGSIVNVESNGVHGNEQP
HSKKPSPNGAVKESNTATSNEKPTLPPEILSMIFETLDDWEVATSVGVYAKIPIPEKWKP
YIPKPGSPSTLEYTILRGSIKEIELQISKIPTFKRLSKIDAHLILKFARTDILNYLVKSR
MDLILSTSELQHIPLYVSTTYNSTALLTWWVNYSSALPPFNIRKGVAECVDAASRAGFVE
VLEWWRQSGFPFRYTERALESASAEGRIAVLDWWKNVSKSAPLDDPVPLKVGKSVLLAAQ
SGQTKSLAWWDKSDIPYGHAESVTRIASNHGHVPVLDFWHQRKREKLIFDNQVLVGATKN
GHVDVLEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWARNGLNLGVGTNEWMMVK
TLNT
Download sequence
Identical sequences A0A2B7Y0T1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]