SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B7ZN42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B7ZN42
Domain Number 1 Region: 141-235
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.19e-16
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00046
Further Details:      
 
Domain Number 2 Region: 466-576
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000955
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2B7ZN42
Sequence length 661
Comment (tr|A0A2B7ZN42|A0A2B7ZN42_9EURO) Uncharacterized protein {ECO:0000313|EMBL:PGH34217.1} KW=Complete proteome; Reference proteome OX=73230 OS=Emmonsia crescens. GN=GX50_02991 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MAVDFTPPHALSPQDSKLEAPRDKVTGMPGVTLDNRGAGTETGGDTHVYGNKNGAVVGEC
EVELDKNNWLSSAKLSCNNKLRKRVLISTNASFAEVAIPFLQKISDVELRVISDDVLDIM
QGSCYPDTPISAQPGSKLSSRPWMNVTAAELISWADVLILSPIDAGTLGGMIAGLTTSLT
LTVLRGWDITKTVLLVPRMTTSEWQSPMTKRQLSDLANFWSWVKVLPPTLSKFEPPAGLV
EIPWDGWATFSSKVRKCLGCPFPPSTIQEDDKLAKDVSSGNGSTPLAIPSSLHERELSVN
NEAYQNGTNKVPTSAIRKEKPILPPELLTMILEMLDDWETAASVGVYAKIPVPEKWKPYI
PTPRTPATFEYTVLRGSMKEIEQQLSTIPPRKPLSRIVTDLILKFSRTDILDSLCKLRMD
LYLSTPQLKNLPLSASSKFGSTSLLTWWRNCSTLPTLPIKDYLPEAIDAASRAGFVHVLE
WWRQSGLPFRYTEKSLESASAEGRIAVLDWWKNVSKNAPPGDPVPLKVGKSVLLAAQSGR
TDSLAWWDKSDIPFSHAESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGHV
EVLEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWARNGLNLGVGTNEWMMVKTLN
T
Download sequence
Identical sequences A0A2B7ZN42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]