SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C6KGT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C6KGT2
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 5.62e-21
Family Major surface antigen p30, SAG1 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2C6KGT2
Sequence length 153
Comment (tr|A0A2C6KGT2|A0A2C6KGT2_9APIC) Srs domain-containing protein {ECO:0000313|EMBL:PHJ15868.1} KW=Complete proteome; Reference proteome OX=483139 OS=Cystoisospora suis. GN=CSUI_010318 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Cystoisospora.
Sequence
MATWLMKVTVETRRSAATDQTVRCAYGATSNKAARPTVTLTPQNNKVTLVCGSKDHTEVQ
PRDYQTNYCADANVGTACKKEAYTTFIKDFKPEWWTKVEATQNVTLTLPPENFPVTAKSI
HLECGYKSEGSRESQAEGSQASRPTVCVGGCGH
Download sequence
Identical sequences A0A2C6KGT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]