SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C6KM96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C6KM96
Domain Number 1 Region: 68-208
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00000000327
Family Major surface antigen p30, SAG1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2C6KM96
Sequence length 264
Comment (tr|A0A2C6KM96|A0A2C6KM96_9APIC) Uncharacterized protein {ECO:0000313|EMBL:PHJ25141.1} KW=Complete proteome; Reference proteome OX=483139 OS=Cystoisospora suis. GN=CSUI_001006 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Cystoisospora.
Sequence
MAVSGPTTRSHITARSSDFRRRRSVFFVLGTAGLAVVLPLFLQGKVPTAAAHGELAELYP
GHPRRLAAKPVPVCGANAEGKQNGKNLELTAKDGLQFKCAAAQTLHPPSTTQNDDFDQVY
EYDKATSTCKGDGIALNSVVTGAKLTRSTQNSLPAAKSAETVYTLSYTGAPTADKSLCYT
CKTSSPSPGDGRASQQAVECTVHITVKAKTPPSPPGGSQQGDTPAPPVNGTTTPPTSTST
SDSRRIAASAAATAATFLPVVFFL
Download sequence
Identical sequences A0A2C6KM96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]