SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9L510 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9L510
Domain Number 1 Region: 91-174
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.54e-28
Family Inhibitor of apoptosis (IAP) repeat 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C9L510
Sequence length 181
Comment (tr|A0A2C9L510|A0A2C9L510_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB027040-PA} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MLMYTADTCHGSTGAPVITFTQRSPKGHFDLDIWMHIGQHKTHGLGCSAMKALEKVDLVT
LESFASQGTAKNDTNETAKYNEDARDSLSKRTLSSQPSYPAFGIYEKRLESFSNWCHEHI
HQPEYLARIGFFYAGYSDCVRCFQCGLGLRSWKPGDNVLEEHKRLRATCSFLQKLLDNVT
R
Download sequence
Identical sequences A0A2C9L510
XP_013078200.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]