SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9V105 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9V105
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.2e-28
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9V105
Sequence length 120
Comment (tr|A0A2C9V105|A0A2C9V105_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY37807.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_11G130400 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MVLLQLDPFLNELTSMFEHSTEKGSVWVTLKRSSLKSKVQRNKMGTVGEPLEYRCLVRAT
DGKKTISTSVGAKDHQRFQASYATILKAHMAALKKRERKDKKKAALAHKQEGGSKKSKKA
Download sequence
Identical sequences A0A2C9V105
cassava4.1_019412m|PACid:17980300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]