SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9WNQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9WNQ8
Domain Number 1 Region: 184-472
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.26e-109
Family Enolase 0.0000000439
Further Details:      
 
Domain Number 2 Region: 47-179
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.37e-52
Family Enolase N-terminal domain-like 0.0000052
Further Details:      
 
Weak hits

Sequence:  A0A2C9WNQ8
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2C9WNQ8
Sequence length 474
Comment (tr|A0A2C9WNQ8|A0A2C9WNQ8_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY61127.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_01G165700 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MSVQEYLDKHMLSRKIEDAVNAAVRAKTSDPVLFISNHMRRVVPSVITKIKARQILDSRG
IPTVEVDLHTNKGMFRASVPSGDVTGMYEAVELRDGDKGTYLGNSVARAVKNVNEKISEA
LIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSIAACKAGAAEKEVPLYKHIADLS
EKTSLTLPVPAFTVISGGKHSGSNLAIQEIMILPIGAGRFAEALQMGSETYHHLKAVITE
KYGEQGCNVGEDGGFAPNISSVQEGLDLVKEAINRTGYNGKIKIAIDVAATAFCIGTKYD
LDFKSPNRSGQNFKSGEDMIEMYKELCNEYPIVSIEDPFDKEDWEHIKYFTSLGLCQVVG
DGLLMSNPKRIERAIHESTCNALLLKINQIGTVTEALEVVKLAKDAQWGVVASHRSGETD
ESFISDLSVALAAGQIKAGAPCRGERLAKYNQLLRIEEELGDQAVYAGEDWRLT
Download sequence
Identical sequences A0A2C9WNQ8
cassava4.1_006818m|PACid:17991960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]