SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D0PJP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0PJP7
Domain Number 1 Region: 130-255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-19
Family Nucleotide and nucleoside kinases 0.00052
Further Details:      
 
Domain Number 2 Region: 3-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000018
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D0PJP7
Sequence length 266
Comment (tr|A0A2D0PJP7|A0A2D0PJP7_ICTPU) adenylate kinase isoenzyme 5-like isoform X3 {ECO:0000313|RefSeq:XP_017306823.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=LOC108255392 OC=Ictaluridae; Ictalurus.
Sequence
MNTNDAKDYLSKRQIPHLFESMLTGLMYHRPEDPLGFLENCLQKTRELGGPECVAWDTFI
MPDRKPLPPITTAQGKKAPCKLDSGPGPGPYRRYDRLPPIQAQFSIESDSDMTESSGLIQ
EYDVFDPLKPRPHIIFIIGGPGSGKGTQTAKIAAHYDFECVSVGEILRNQLLQHAPSDRK
WELIAQIIANGELAPQETTIEELKHQFIKKQDAKGFIVDGFPREISQVFTFEEQVDADRE
EDEIFTDIKAIVKEKLFSKEEEPKGL
Download sequence
Identical sequences A0A2D0PJP7
XP_017306823.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]