SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D0SWZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0SWZ9
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D0SWZ9
Sequence length 692
Comment (tr|A0A2D0SWZ9|A0A2D0SWZ9_ICTPU) uncharacterized protein LOC108278372 isoform X4 {ECO:0000313|RefSeq:XP_017347202.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=LOC108278372 OC=Ictaluridae; Ictalurus.
Sequence
MAVPFSNTALRVPRGFGNILEGLAREVLRDQPEDIPTFAAQYFTALLQKREEGGLDPAKW
GGLIEHRISNNDSFSDAVNQEMCSPDEETGSSVNEERDFQSDLYENNEDKITQSSQNSSP
SPETLDAPKDIVEWEPQANNELNKSEDESGESDSELHPELNSYRGTADVGICAEELNKME
KVEKQMLQNVPEHASVDDENETAEKELDPVTLSSYRGLADVDVCSEELQSTLQEEEHTEG
SGDVTGADAGFIPPSESPDPVLVEQDVLDSHDEFTLTGTETSVYVEQDVDKELNDISCNE
KTIASPVKEDEIDETGHLSEDVREMTNTLFDDAGPEIHHVEQLHLNEGAESISVSEEAQT
FDETNTDEIPLGVENQQASDILAAEAMSESSFILEKDSLTDRRNKDKPEIEDFVNVASEL
QEEHNDFESVSDIIAATDERDSQTDIQEDETNDDKQTDPKDIFETIPVENMEGLVDNPTG
FSDEDVNKDGTRTSQNVDEVEDTSDIDEGSNGVNAPDTLEDNLFYSTFTHESKATLPVPT
SEETEQDMEVNYKQSATDSQEHPVETETATDYEESEHQEDVVYEPILESENKEVDQQLEN
NKQSWVRGARAPISLASPFSSISPEKNIFISMDCHCEESSQPQEEEDIMDIPLDDPEANK
AAAKIQAGFRGHMTRKKLKPGDKPGEEGDQKE
Download sequence
Identical sequences A0A2D0SWZ9
XP_017347202.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]