SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D1TWT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D1TWT4
Domain Number 1 Region: 7-201
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 3.92e-43
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D1TWT4
Sequence length 212
Comment (tr|A0A2D1TWT4|A0A2D1TWT4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:ATP53828.1} KW=Complete proteome OX=74426 OS=Collinsella aerofaciens. GN=CSV91_04350 OC=Coriobacteriaceae; Collinsella.
Sequence
MRMSQEMMDKTCRGFAEALAAREPVPGGGSASAFVGALGASLCGMVARYGATNPALADRA
DDLTRAFAQADELAQELVELVAEDVRAYGQVSAAYGIPRGDPARATAIQDALHVAAMPPY
RIMDACGRALALLEDMADKGSRQLLSDVACGAVFCRSAMQGASLTLFANTTSMKDRARAE
ELETACDELLDTWLPRADALARRAADAARKRG
Download sequence
Identical sequences A0A2D1TWT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]