SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D2SAW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2D2SAW1
Domain Number - Region: 18-72
Classification Level Classification E-value
Superfamily BAG domain 0.033
Family BAG domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D2SAW1
Sequence length 134
Comment (tr|A0A2D2SAW1|A0A2D2SAW1_XANCI) Uncharacterized protein {ECO:0000313|EMBL:ATS46089.1} KW=Complete proteome OX=473423 OS=Xanthomonas citri pv. phaseoli var. fuscans. GN=XcfCFBP6989P_12345 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MSEILVPVSFGELLDKIAILQIKSERMRDAAKLANVRNELSALETSWMAHPAAGHDIVRL
RAELKAVNERLWVIEDDIRLKEQAQSFDAAFVQLARSVYIENDERARIKKEINLALGSSY
VEEKSYQDYRATGA
Download sequence
Identical sequences A0A1U8Z8B3 A0A220WKA9 A0A2D2SAW1 A0A2H1QST3 A0A2H1T9D2 D4T0W6 D4T884
WP_007968982.1.17148 WP_007968982.1.35849 WP_007968982.1.52489 WP_007968982.1.53650 WP_007968982.1.57989 WP_007968982.1.82045 WP_007968982.1.86317 WP_007968982.1.87207 WP_007968982.1.97233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]