SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D3DU12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D3DU12
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily BH3703-like 9.68e-43
Family BH3703-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D3DU12
Sequence length 147
Comment (tr|A0A2D3DU12|A0A2D3DU12_BACIU) Uncharacterized protein {ECO:0000313|EMBL:ATU28811.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=BMJ37_03630 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
METKQMQDLYHIIGEKLNDIIPCEWTKIYLYAEVLDDSTMVLFHFKTPEKHQLIYSQNIP
VRYSVSKDIFKTLLREIRELFEELRAEHKNNNDQVWTNLTLTLESNGQFQLDYNDDDILA
SELDGYQRIALWEYKTLGILPKDEVFN
Download sequence
Identical sequences A0A2D3DU12
WP_050569582.1.80415 WP_050569582.1.95227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]