SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4C2E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4C2E5
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily EF-hand 0.0000451
Family Polcalcin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4C2E5
Sequence length 138
Comment (tr|A0A2D4C2E5|A0A2D4C2E5_PYTIN) Uncharacterized protein {ECO:0000313|EMBL:GAY00715.1} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_008578 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTTPARRVSATDKGLNMKXPKVRANLYMQTHGIKELFDGLGTLLLFHRPDXPRAFLAQHL
ADLQRSKQNQSHDLDAMFASFDVNDQGFITPAQYDQALKSLGIDRPTLRLPESISQITHS
LFTRSMTQEIKNASASFM
Download sequence
Identical sequences A0A2D4C2E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]