SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4C9K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4C9K5
Domain Number 1 Region: 778-1095
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.27e-49
Family Regulator of chromosome condensation RCC1 0.0052
Further Details:      
 
Domain Number 2 Region: 274-517
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.63e-19
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 1447-1583
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0000000000484
Family beta-lactamase inhibitor protein-II, BLIP-II 0.063
Further Details:      
 
Domain Number 4 Region: 557-661
Classification Level Classification E-value
Superfamily EF-hand 0.000000571
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 5 Region: 104-133,163-237
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000942
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4C9K5
Sequence length 1590
Comment (tr|A0A2D4C9K5|A0A2D4C9K5_PYTIN) Uncharacterized protein {ECO:0000313|EMBL:GAY02941.1} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_010765 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAAATIRIIKEALALPAPLELVTLKRXNQEPDGVHELSVIDAASAGDLALFQRTVGRYVE
AKTDPCLLEHWLNHAARSAAMRGHAAIVQHIVSQHAPDLLMAPVMEAVARRGELELLQWL
FERRGERPATVLVXATRAAAEGGHVPVLEWILGVLGRAEFPCDAMADAVDRGHVPAAQWF
KDRELHTGVMLHAYVTILAGHVDMVKWLRENQLGVFDSMAIAASYQGGHLPLIEYFLAEE
LIEHSPLLTSSTMWGGHCELAIYFDEVVGVGCPYTTLWGAARLGRLDVCDRLLQRYPAFA
TQTMNLDHACESGDVAVLEWIDAHLGAHAKFSKTGVSFAAHGGHLACVQWLTQKVPAPWP
KEIMDVAAEEGHLELVQWLHEHRSEGCSKKAMDSAAAKNRLEVVQWLHANRSEGCTVRAM
NDAAANGHLEMVQWLHANRDEGCSVNAMNRAAASGHLAVVEFLHANRSEGCTSDAMRLAA
ANGHLEMVQWLHAHRSEQWTSDAVDAAAANGHLAIVNPFSSSCSSSMGGRFSHVHYRAQD
AVVVPHFQLITQVWGLEEIALLSRKLRQLSFNFCLTPEXXGDWLALRHNALFQGMLQRWF
DSFRNTPSSTVVNGLELLAALAIASXDGKLVDKLXXVFDVFDFDDSRMITLDELCILLKS
VVRGLSKITVGLGPRLASLSAMREVGALARQCTPKLVNLLRCFVRREFLTREDAAVTIQR
CTRGMLSRREAAERRLELQLELHQELHDAAQKIQDAVVSRKKKRDTMRQIKIEKFAHHGA
LYSFGSNARAQLGHASLELSQQLSAPLLASYFKNNELRVTHAALSSAHACAVTSDGQIFT
WGAGVPGSFGFLSRALSKDKHSDADDHVVLSQIRKAPARVEDLDDVVIASCALGSHHSVA
LSQSGVLYTWGSGAFGQLGHGDIRSEGHEIFKRQFDQHTGREYPIVELPLQLDRSFFEEM
RVLQVACGYYFTVAVCEDGSVFTWGEGSDGQLGVGYSDHFSVGFLDEHIHGSSFVYMHSP
TRVDELKEPIASVAVGGNHVFAVARDQRHVFEWGAWHRRGGDAQDSAFSPQRNDFLSTLA
VSSIASGKEHTLAVGARVEIALFIERPYQREAVESTRAVVKGAGLCALFGAPPVALLTRA
LTGPLFVYGQSSGSAGYSVTAASGSSASASTAAASRAMDRTSGSMAAMLTSTVYDRKESQ
IRSSLSSCTGKIVYVDRSTSTGHWVVVPMIDDQSSSKSVTLLEIPCAPAAFGPEVTEAGI
AAKVWYSPEKLESLRLYVRPDEVVGRVVVLEFDQDDISFESDDLELSEMISLIMISLVEK
VKDAQESGAAAVVIXFDFLDADAFPLQAADDEDFEFKVPVVMVKKAGQGELLLHEVSRAS
KPFAMVCYREDILSKQILMAQRNGAKAVIVGQSRIDQHPVRLRKAIFEVGQAKASEAAGV
KIPVVMVPFRVGEQLKDAAKGVDVEDTTAQLGVSGPGMLYAWGYGENGRLGLGEIDNEEI
FETGFDGARQTSYQFVSSPELVSSLFYKQITHIACGEEHSAAVSSTNPTHTVCFFMRLTR
YFTRQATACCTAWGSGRDGKLGQRLRTTTN
Download sequence
Identical sequences A0A2D4C9K5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]