SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4CG06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4CG06
Domain Number 1 Region: 13-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000772
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4CG06
Sequence length 169
Comment (tr|A0A2D4CG06|A0A2D4CG06_PYTIN) Uncharacterized protein {ECO:0000313|EMBL:GAY05505.1} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_013316 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MDGVTGLLRQFPDAVKSGSIRAMDMLADRDSSAPSMRQAMKTAIHDNQAEVLQWLLDRFA
TPSIGQRLWAVALNSFCGDYGVIECLLRNFPTTPLNTGESINFELFRFLLSRHMHVVVSQ
CAFRDMMSNGDESLVELIAKSDCEIEVHYDDIPDLFLLFGRSESDIVFS
Download sequence
Identical sequences A0A2D4CG06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]