SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4HQY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4HQY6
Domain Number 1 Region: 120-241
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-32
Family cAMP-binding domain 0.00000053
Further Details:      
 
Domain Number 2 Region: 249-373
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-31
Family cAMP-binding domain 0.000000565
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.05e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4HQY6
Sequence length 382
Comment (tr|A0A2D4HQY6|A0A2D4HQY6_MICLE) Uncharacterized protein {ECO:0000313|EMBL:LAA74410.1} OX=129467 OS=Micrurus lemniscatus lemniscatus. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MAASSSSSSEEERSLRECEHYVQKHNIQQLLKDCIVQLCTVRPERPMGFLREYFERLEKE
ETKQFICQQKASSRTDSREDEISPPPPVNPVVKGRRRRGAISAEVYTEEDAASYVRKVIP
KDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVVDQ
GEMDVYVNSEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGST
LRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGT
AAVLQRRSEHEEFVEVGRLAPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVL
GPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A2D4HQY6 U3FXC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]