SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4L4M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4L4M7
Domain Number 1 Region: 20-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 
Domain Number 2 Region: 75-113
Classification Level Classification E-value
Superfamily EF-hand 0.0000733
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4L4M7
Sequence length 141
Comment (tr|A0A2D4L4M7|A0A2D4L4M7_9SAUR) Uncharacterized protein {ECO:0000313|EMBL:LAB15978.1} OX=1970185 OS=Micrurus paraensis. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
PLRGASLARRLATAMDRETEGREYLAQHKIPELLYSLTSLLLYHRPERPREFLIKTLEKV
KIAKASSNDYPNLMDESNLDAMFDMIDVGGEGYINVIQYKGALESLGLNNQEVPYKENEI
ITSKVFKENVTKKLTELWTTV
Download sequence
Identical sequences A0A2D4L4M7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]