SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4PSJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4PSJ9
Domain Number 1 Region: 120-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.12e-33
Family cAMP-binding domain 0.000000596
Further Details:      
 
Domain Number 2 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 6.41e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4PSJ9
Sequence length 278
Comment (tr|A0A2D4PSJ9|A0A2D4PSJ9_MICSU) Uncharacterized protein {ECO:0000313|EMBL:LAB60199.1} OX=129470 OS=Micrurus surinamensis (Surinam coral snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MAASSSSSSEEERSLRECEHYVQKHNIQQLLKDCIVQLCTVRPERPMGFLREYFERLEKE
ETKQFICQQKASSRTDSREDEISPPPPVNPVVKGRRRRGAISAEVYTEEDAASYVRKVIP
KDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVVDQ
GEMDVYVNSEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGST
LRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFE
Download sequence
Identical sequences A0A2D4PSJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]