SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4PZ52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4PZ52
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.14e-18
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4PZ52
Sequence length 288
Comment (tr|A0A2D4PZ52|A0A2D4PZ52_MICSU) Uncharacterized protein {ECO:0000313|EMBL:LAB63237.1} OX=129470 OS=Micrurus surinamensis (Surinam coral snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
LQIPYEKAEDIRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQHIF
MNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMVMAELVNA
GEDVLVFYNDRASFQTLVQMMRSERDRMDENSALMYHIHLVELLAVCTEGKNVYTEIKCN
SLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDI
CRTCNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQVRN
Download sequence
Identical sequences A0A2D4PZ52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]