SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4RA96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2D4RA96
Domain Number - Region: 113-172
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0602
Family Tubulin chaperone cofactor A 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4RA96
Sequence length 176
Comment (tr|A0A2D4RA96|A0A2D4RA96_9GAMM) Primosomal replication protein C {ECO:0000313|EMBL:MAA61843.1} OX=1874361 OS=Idiomarina sp. GN=CMF09_03525 OC=Idiomarinaceae; Idiomarina.
Sequence
MREILNVTSIQHIEQLLNTLQGRAEQIDGENRKKHRQLSENWFSSSLFSQSSNLAVDYVA
ETQNLFRQLQKSDNHHAQRYLAEKLSLQLEALNTAFRANRPPKQQQDHRITAQNQLQQMH
QQLVTYRDYERRLTENLDTAAAGNNPTMIQSAQQRLNRCQMAIDSLEKKISRYEEG
Download sequence
Identical sequences A0A2D4RA96 Q5QWS5
gi|56460960|ref|YP_156241.1| WP_011235092.1.4909 WP_011235092.1.75540 283942.IL1860 gi|507386289|ref|YP_008035368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]