SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D5X316 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D5X316
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.0000000000759
Family Nucleolar RNA-binding protein Nop10-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D5X316
Sequence length 78
Comment (tr|A0A2D5X316|A0A2D5X316_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MAE39083.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CL969_05640 OC=Archaea; Euryarchaeota.
Sequence
MIEGIEMARSKMQKCLECGAYGLSTTCKECGGVAQAAGPLKFSPHDPQSERRRKYEKVTE
PEWADKLPSPKKEKEDSE
Download sequence
Identical sequences A0A2D5X316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]