SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D5YHR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D5YHR2
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 1.31e-27
Family Dom34/Pelota N-terminal domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 248-341
Classification Level Classification E-value
Superfamily L30e-like 0.0000000000000023
Family ERF1/Dom34 C-terminal domain-like 0.0029
Further Details:      
 
Domain Number 3 Region: 130-241
Classification Level Classification E-value
Superfamily Translational machinery components 0.0000000000255
Family ERF1/Dom34 middle domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D5YHR2
Sequence length 341
Comment (tr|A0A2D5YHR2|A0A2D5YHR2_9EURY) Protein pelota homolog {ECO:0000256|HAMAP-Rule:MF_01853, ECO:0000256|SAAS:SAAS01014537} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CL964_00410 OC=Archaea; Euryarchaeota.
Sequence
MRVQSRRDGVVKLWLEHDDDLYHLDLLLEPGDAVRASTERREAVQADRLRAERGRKKKLT
LTLEIEKVEYQPFGQRLRCHGPITEAKRDVGQHHTLLLESGDDLILAKTKWAPHHKRRLQ
EAAQPVVRALAVAIEADSVVLAEVRPYGIRELRSLNRAGGKGTGGETQKAFFARVCTSVA
DTLGSDSVGAALIVIGPGFLKEDLLKQARADSPELWGGANAVTAGQGGLAGVHEALRSGK
LPQAAAQVQLQRELEAVELLNNALAKNLATYGIAQLRAALEAGAGERLLILAAETRSPKG
RQLLALAEQARTEVVEVSSHHHGGEILDGLGGAAAVLRYKL
Download sequence
Identical sequences A0A2D5YHR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]