SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D6QE21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D6QE21
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000051
Family Carboxypeptidase regulatory domain 0.066
Further Details:      
 
Domain Number 2 Region: 119-177
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000267
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D6QE21
Sequence length 204
Comment (tr|A0A2D6QE21|A0A2D6QE21_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:MAG63425.1} KW=Complete proteome OX=2026803 OS=Candidatus Woesearchaeota archaeon. GN=CMO84_07880 OC=Archaea; Candidatus Woesearchaeota.
Sequence
MKILLPTLLLFFVSASQEAQVDSAPIRGQVVDEEGAPVAGARYWVSGFEERVDGEWRLVF
FTGETLVSTTDAEGRFELPTRPGLRYDLDFDIHGKAPAFYTQVEAGAQLKVVVHEGLDVA
GRVVLENGDGIAGFEVGLERPNGRGVWFRTRARTDEDGRFEFPAFREGGEWQVTVGRATL
PLEAKQGEVVDDLLVEIRLSRTGR
Download sequence
Identical sequences A0A2D6QE21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]