SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D6TYC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D6TYC3
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 4.19e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00079
Further Details:      
 
Domain Number 2 Region: 80-176
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000157
Family Cold shock DNA-binding domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D6TYC3
Sequence length 195
Comment (tr|A0A2D6TYC3|A0A2D6TYC3_9ARCH) DNA-directed RNA polymerase {ECO:0000313|EMBL:MAH06924.1} KW=Complete proteome OX=2026773 OS=Candidatus Pacearchaeota archaeon. GN=CMI38_01580 OC=Archaea; Candidatus Pacearchaeota.
Sequence
MFYNIEVEDYVRVEPRLFGLKTSDAVAKQLQETYSDYHDKEIGEVIGIIAVLEVGDGVII
PEDGAAFYKSKFRLLVWKPELQELVFGLIDEITNFGAFINLGVMKGIIHISQTMDDYVTF
SSTGTLLGKDSKKVLKKRDPCIARIVALSYKGDQPKIGLTMRQPGLGKLDWITEEKKKSK
SLVKKASNDDKKEKK
Download sequence
Identical sequences A0A2D6TYC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]