SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D7AR41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D7AR41
Domain Number 1 Region: 6-209
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 1.44e-46
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D7AR41
Sequence length 209
Comment (tr|A0A2D7AR41|A0A2D7AR41_9EURY) Methenyltetrahydrofolate cyclohydrolase {ECO:0000313|EMBL:MAH90169.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMA11_00200 OC=Archaea; Euryarchaeota.
Sequence
MKTPWMEMTVRDFQAALASSSPTPGGGTAAAISLGQASALTIMVSDLTIGKEKWQEGWDI
ANHAMLAAVKIMSRAGVLADEDSNAFDDVMASFKLPKDDDEQKDARRKAIRSATLQATQI
PYETAKLSLQLLEMLPDLARKGNANAVSDVGVAGLLASAACKGALFNVDINLSSLPSEMA
AEIRQGAPEILEKSRVLSREIMDAVRDRL
Download sequence
Identical sequences A0A2D7AR41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]