SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D7GS54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D7GS54
Domain Number 1 Region: 17-260
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 2.75e-62
Family Outer membrane phospholipase A (OMPLA) 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D7GS54
Sequence length 266
Comment (tr|A0A2D7GS54|A0A2D7GS54_ALTSX) Uncharacterized protein {ECO:0000313|EMBL:MAI64012.1} OX=232 OS=Alteromonas sp. GN=CL600_03880 OC=Alteromonadaceae; Alteromonas.
Sequence
MDPLRRKWVDLLGCQSTPHKGTYLLPFSHNDNPNSNTFKTIEDENKDRGTFYERTETEFQ
ISFLILTNKNIFNTNFNTFIGYTHRAYWQVYNKDWSRPFRETNYMPEIFARYVFDKPPKI
LNAHYIGYDIGFVHQSNGQVQELSRSWNRIFSRFTFLAGSTFFNFTLWYRLPESKDENEN
PYMYKYRGYGEIDMRHEFGELDLRLRILPGTEHISGEFALSYPWKEGIRFYSKISYGYGI
SLQDYDHESRRIGLGLILSDPISSTD
Download sequence
Identical sequences A0A2D7GS54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]