SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D7VAC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2D7VAC7
Domain Number - Region: 23-52
Classification Level Classification E-value
Superfamily WWE domain 0.0381
Family WWE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D7VAC7
Sequence length 86
Comment (tr|A0A2D7VAC7|A0A2D7VAC7_ACISP) Uncharacterized protein {ECO:0000313|EMBL:MAK29624.1} KW=Complete proteome OX=472 OS=Acinetobacter sp. GN=CL490_03680 OC=Moraxellaceae; Acinetobacter.
Sequence
MYNHEIVLQDKIFRRCSVVRVKDTIYDPSKNTFSEQWFWIYAENSEFFPFDLWEKLDHAE
INQIIQDERHFYKVIKVITKKRRRLI
Download sequence
Identical sequences A0A2D7VAC7 Q6FAJ4
62977.ACIAD2111 WP_004927592.1.43955 WP_004927592.1.60904 WP_004927592.1.84452 WP_004927592.1.9579 WP_004927592.1.98780 gi|50085231|ref|YP_046741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]