SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E0ELR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E0ELR9
Domain Number 1 Region: 22-323
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-29
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 304-404
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000109
Family Pseudo ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E0ELR9
Sequence length 524
Comment (tr|A0A2E0ELR9|A0A2E0ELR9_9RICK) Uncharacterized protein {ECO:0000313|EMBL:MAR56404.1} KW=Complete proteome OX=2026788 OS=Rickettsiales bacterium. GN=CMM93_04400 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales.
Sequence
MEQIKNYCKSQNIEADNLNRVFQIACREGHLDMVKFILEYAKINNLKIVINALEDYAFLV
ACENGHLPVVKFLLSLSTNSFPNDASFEVEENDSSFKININAYEEYALRMACENGHLDVV
KFLLEYAEKNNLEININAEDNHAFVMACGNGHLDVVKFLLSLNDSSFKVSTPTSLVEENA
EKNNFDFKIDAEDNHAFQYACEKGHLPVVKFLLEYAKENNLEININAYEERPFRYACANG
HLPVAKFLLEYAEKNNREIDIHAQGEYAFRHVCRKNNLDMVKFLLEYAKINNREIDINAH
NDCAFRHVCRKNNLDMVKFLLEYAKINNREINISAEEDFAFKYSCENGHLDMVKFLLEYA
EINNLKININAKDDYVFRHTCANGHLDVVVFLLSLSTSNDTFSTNELVEVEENDSSFKNA
KMNNREIDIHAEEDFAFRCCRNEKIIDLLLPLLNRNKDEFYFYKEKEYYILKPLDCEMSL
TGTKFEHFQVYHRKSTYLNDCIDAYQVYLRRFRKKSAFSMIYDH
Download sequence
Identical sequences A0A2E0ELR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]