SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E0V9V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E0V9V3
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 5.89e-24
Family RNA polymerase subunit RPB10 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E0V9V3
Sequence length 73
Comment (tr|A0A2E0V9V3|A0A2E0V9V3_9EURY) DNA-directed RNA polymerase subunit N {ECO:0000256|HAMAP-Rule:MF_00250} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMA27_00230 OC=Archaea; Euryarchaeota.
Sequence
MLIPIRCFSCGTVIADRWTKYKELIKSKDEGGEGKSVEEALDEIKLTRYCCRRMYVSHVE
LIEEVAPFSTYRY
Download sequence
Identical sequences A0A2E0V9V3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]