SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E0YEF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E0YEF7
Domain Number 1 Region: 32-74
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000929
Family Preprotein translocase SecE subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E0YEF7
Sequence length 88
Comment (tr|A0A2E0YEF7|A0A2E0YEF7_9EURY) Protein translocase SEC61 complex subunit gamma {ECO:0000313|EMBL:MAT86567.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CL997_05245 OC=Archaea; Euryarchaeota.
Sequence
MSDENAEKRSFENYVQDKQDAIEAQFRRISRGSWARILRMARKPTPQEFKQTSIICGIGL
FVLGFIGFVILVLMDNFIPWIIHDVFGI
Download sequence
Identical sequences A0A2E0YEF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]