SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E2EE84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E2EE84
Domain Number 1 Region: 1-128,156-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-33
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 123-158
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000000916
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E2EE84
Sequence length 209
Comment (tr|A0A2E2EE84|A0A2E2EE84_9PROT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} OX=2026745 OS=Halobacteriovoraceae bacterium. GN=CME66_01770 OC=Halobacteriovoraceae.
Sequence
MKNLILLGAPGSGKGTQSQLLVERLSYKHISTGNLLRSEIEKKSDLGLRVKEVMDAGKLV
SDELVEELLKANLKLEDDSYIFDGYPRNLDQAKTLTGILGHHDYTALFFKLDTEKLVERL
KNRRVTKDGKYIYNLITNPPKTSGVCDVTGEPLIQRDDDKEEVVRKRMEVFEETINPVLS
YYKDLGKFVEIQADNGLDKIYDEIVSKIN
Download sequence
Identical sequences A0A2E2EE84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]