SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E2S8I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E2S8I9
Domain Number 1 Region: 93-250
Classification Level Classification E-value
Superfamily MTH1598-like 7.06e-17
Family MTH1598-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E2S8I9
Sequence length 250
Comment (tr|A0A2E2S8I9|A0A2E2S8I9_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MAZ23177.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMB22_00020 OC=Archaea; Euryarchaeota.
Sequence
MATSGRMAQRSITRTKTMTLCGQDGSITSDSIRSILQMQMSTQTGTDSSTSARISGTRTP
RTQPASHHRASYATHSPDRSVHATRPTGGNDRMSWWILPTTADIGIRAFSSSPEGAIEEA
TLGMQSIQISESGAESVNSLVRNTGTWSVKIEGNDLQRGMVRWMEEVLYMCDGEGKWLVD
SSISIGDGSISAQVSWVDSDSVEREIEVKAITMHELLLRKVEEGELLSGVDNDIPSFEGP
GWVAQVVLDV
Download sequence
Identical sequences A0A2E2S8I9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]