SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E3XK79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E3XK79
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 9.16e-25
Family RNA polymerase subunit RPB10 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2E3XK79
Sequence length 68
Comment (tr|A0A2E3XK79|A0A2E3XK79_9EURY) DNA-directed RNA polymerase subunit N {ECO:0000256|HAMAP-Rule:MF_00250} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMA43_00230 OC=Archaea; Euryarchaeota.
Sequence
MIIPVRCWSCGKVIAHAYEGYKKAVEAGEDPDKAMDDAGLDLYCCRRMFLGHVELIDEVA
PFSIPREQ
Download sequence
Identical sequences A0A2E3XK79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]