SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E4BHW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E4BHW3
Domain Number 1 Region: 259-367
Classification Level Classification E-value
Superfamily L30e-like 6.47e-17
Family ERF1/Dom34 C-terminal domain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 19-139
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 0.00000000000000105
Family Dom34/Pelota N-terminal domain-like 0.00064
Further Details:      
 
Domain Number 3 Region: 146-262
Classification Level Classification E-value
Superfamily Translational machinery components 0.00000000137
Family ERF1/Dom34 middle domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E4BHW3
Sequence length 367
Comment (tr|A0A2E4BHW3|A0A2E4BHW3_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MBD43375.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMB09_04680 OC=Archaea; Euryarchaeota.
Sequence
MMTAIKLESLGECMQILKREPMLWRLRIVGQDDLWSLARLARKGMSLGMLGERRDQTTAG
EEGGRAKSAERKKMWIRLRIETTEYQSFGDNLRCHGIIEEAKFDLGSHHTHNISVGDEIE
LSCITEFLDTDKQLLQQAIDAAKQVQVALAVVENDEVILFHVTSRGLRESTTWTMRGGGK
RVDVKQSSGVAKGFREKVIKELTESLAKDTPLILCGPGHAREIYLQDMKSAGQTRLISSI
ATSMSGRAGANEILREGLAGNLLEDYAISKEIGLLEEAWMRVSTNGAVAYGLMELTKARN
EGAIETLLISADLLRDEEAIIDGTSWQLWCKSLSDIGGEMVQCSTDHDSGQQLLGIGGAI
ALLRFKI
Download sequence
Identical sequences A0A2E4BHW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]