SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E4YA22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E4YA22
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000405
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2E4YA22
Sequence length 135
Comment (tr|A0A2E4YA22|A0A2E4YA22_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:MBG10109.1} OX=1913989 OS=Gammaproteobacteria bacterium. GN=CMD92_02960 OC=Bacteria; Proteobacteria; Gammaproteobacteria.
Sequence
MVFIALFATALTYGYRGDPMTLALISAARTGNMAALSSIVHSQGRGMINLDPAFVEASAY
GRIKAMQFLVARGAHDFTGALVRASLRNQIGAVRHLLDSDAYEIEEADLRLARLAAGGAD
STEVEFLLVTRLMRG
Download sequence
Identical sequences A0A2E4YA22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]