SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E7FYK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E7FYK6
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 2.09e-16
Family Dom34/Pelota N-terminal domain-like 0.00068
Further Details:      
 
Domain Number 2 Region: 249-347
Classification Level Classification E-value
Superfamily L30e-like 0.00000000000000297
Family ERF1/Dom34 C-terminal domain-like 0.0044
Further Details:      
 
Domain Number 3 Region: 131-244
Classification Level Classification E-value
Superfamily Translational machinery components 0.000000000131
Family ERF1/Dom34 middle domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E7FYK6
Sequence length 348
Comment (tr|A0A2E7FYK6|A0A2E7FYK6_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MBN16588.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMB37_00300 OC=Archaea; Euryarchaeota.
Sequence
MQKIKSIENGVRLRVQHEDDLWTLAQIVTSKCRVGMMGYRRDQSTGTQESGRAKSADRKP
MWIVLDAESNEFQPFTDNLRIHGIIWEAPIDKGSHHTHSVRPRDEIEISWEGGIADSDQQ
LLDESINDSGKGRVAIAVVESDEILLFEIAQHGMRQVGDTFTLRGGGKREAKSSEVRKAF
LNQVAGQVSKAVSHEMPIIICGPGMAREQFESLLKKTGSEHKVLNIATSIGGRAAANEVM
REGGADMLLGEFAMANQVRLIEEALVRISTNGAIAYGKRNLEEALQQGAIESLVIEAGLL
RSDAFWSEAAALVRAAGGEVIQASADHDAGEQLMGLGGAIGLLRWNLE
Download sequence
Identical sequences A0A2E7FYK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]