SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E7G826 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E7G826
Domain Number 1 Region: 29-142
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000366
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E7G826
Sequence length 209
Comment (tr|A0A2E7G826|A0A2E7G826_9PROT) Uncharacterized protein {ECO:0000313|EMBL:MBN19900.1} OX=2026715 OS=Bdellovibrionaceae bacterium. GN=CL678_01335 OC=Bdellovibrionaceae.
Sequence
MKKIILTLALTILFTVNSNAAALSPNTQFHFAILDQEFDPELMNQLIDEGANVNGYYKST
EGPFTHLQAAYAIAINNNDLSRMNYLLEKKADPDFTLDQRTILGRTVEHIYYANSKEELN
TVVEMVKLLVDHDANPCALPNRAKKSAYERLKEINKETEIKSENLKFALNIHAYRSEKKI
KIKKQLELKLKYIKASLSIMDLSFYCSSR
Download sequence
Identical sequences A0A2E7G826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]