SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E8IXI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E8IXI7
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily MTH1598-like 0.000000000000131
Family MTH1598-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E8IXI7
Sequence length 165
Comment (tr|A0A2E8IXI7|A0A2E8IXI7_9EURY) Uncharacterized protein {ECO:0000313|EMBL:MBQ58927.1} KW=Complete proteome OX=2026739 OS=Euryarchaeota archaeon. GN=CMA66_00055 OC=Archaea; Euryarchaeota.
Sequence
MSFWTRETTADIGLRVFSNNLSNLFKETAIGMQSLLISTQESLLLNQKIRHTSQWNVTFN
ITSELDYESLMIIWLEEVLYRLEVHGEFLVDAQCMIEVNEQEMFCQSQVSWVKSSEINKE
LEIKAVTSHEFLIQELKLGQSIVGNELDIPEMVGPGWICDVIFDI
Download sequence
Identical sequences A0A2E8IXI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]