SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2F0AXN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2F0AXN7
Domain Number 1 Region: 26-102
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.00000000000000288
Family Interleukin 8-like chemokines 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2F0AXN7
Sequence length 110
Comment (tr|A0A2F0AXN7|A0A2F0AXN7_ESCRO) C-C motif chemokine 17 {ECO:0000313|EMBL:MBV95524.1} OX=9764 OS=Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus). GN=ESR_16709 OC=Mysticeti; Eschrichtiidae; Eschrichtius.
Sequence
MTSLKRLPLAALLLAASLQDTHAARGANVGRECCLQYFKGAIPLRKLVRWYRTPEDCPRD
AIVLRVLVSAGLVTLHGRSICSDPKDVQVKKAVKHLQNTTKPRYLAAQPS
Download sequence
Identical sequences A0A2F0AXN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]