SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G1DIW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G1DIW3
Domain Number 1 Region: 15-165,227-357
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-51
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 266-580
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.47e-42
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 190-244
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000889
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G1DIW3
Sequence length 630
Comment (tr|A0A2G1DIW3|A0A2G1DIW3_9PROT) Uncharacterized protein {ECO:0000313|EMBL:PHO18427.1} KW=Complete proteome; Reference proteome OX=870501 OS=Arcobacter molluscorum CECT 7696. GN=CPU12_05390 OC=Campylobacteraceae; Arcobacter.
Sequence
MLNKLFKKYTREDLLEALKSSTFNDTKADAMLKDVDVNYRDETNKTYLHIIAEANLVESL
KWLISKKVDINALDTENNTPLIYASRYGCTQAVRTLLQLHADPNIVNAKGRTAIQEALKN
NKKDVYVLLKNVTKNLDNVDEDGHTIIFDAIDSQNVDLVKDVIKLQGNALNKKILFYPNT
YANTAIIKFLSEFIDLNTPDERGRTPLFYLVKNGALNIDSFTFAMEKGADINHVDEDGNT
VLMALIEEIIETDPSEKEKIKNLIGMIPWLIDENVDYNLCNKNGDNALMLATKNNNLKVV
ETLLDYEVDPNYINDRNETALAFAAVKGKSNIDLVSLLLDYGARPNISDENGKTIIEKLI
EIELYLRNKKKLKMKARQQINENENYKSVLEEILLNGEVNLTMLNSEGNPYFFDAVEHGN
IDLVKMLVKYGADINLKNKDGYNIIYYYMSKNISFRKIADQQNYLIMLRNIISLGADPNS
RDDFGGITLHKAILDNDIQTIKVLINAGADINAVDNKGRNMVHNAMWQNKVKVFRLLYSY
NKQLINKPDKFGVLPINYAAFLGYNELVIELIDSGSYVNNPYKKTHYIFNFLKKFHKNLR
PLLENTRNPADHLKMKTLVENMIKEFNVKL
Download sequence
Identical sequences A0A2G1DIW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]