SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G2RRK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G2RRK7
Domain Number - Region: 8-38
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0458
Family PA2201 N-terminal domain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G2RRK7
Sequence length 182
Comment (tr|A0A2G2RRK7|A0A2G2RRK7_9GAMM) Protein Syd {ECO:0000256|HAMAP-Rule:MF_01104, ECO:0000256|SAAS:SAAS00851392} KW=Complete proteome OX=196024 OS=Aeromonas dhakensis. GN=AAW03_10760 OC=Aeromonadaceae; Aeromonas.
Sequence
MSDQVLSALEHFFLRWQRDGEARRGLPLCEWEADWRSPCELDEPKEGRVAWRPHRRAEPA
DFTAMNEALELTLHPAAQALFGGWFSRPVPCLYKGLRLEFVLPWNEADLDLLKENLIGHL
LMLRKLKRSPSLFIATTRNEMTLVSLDNESGQVWLEWLDSGRRLVLAPSLPAFLERLETL
PQ
Download sequence
Identical sequences A0A1C2L1F2 A0A2G2RRK7 A0KHE8
gi|117620266|ref|YP_855699.1| WP_011705080.1.100377 WP_011705080.1.12787 WP_011705080.1.16146 WP_011705080.1.28436 WP_011705080.1.41987 WP_011705080.1.48811 WP_011705080.1.62121 WP_011705080.1.62309 WP_011705080.1.64737 WP_011705080.1.65522 WP_011705080.1.67280 WP_011705080.1.69299 WP_011705080.1.81915 WP_011705080.1.93930 WP_011705080.1.97559 YP_855699.1.44769 380703.AHA_1158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]