SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G3CA13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G3CA13
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000915
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G3CA13
Sequence length 69
Comment (tr|A0A2G3CA13|A0A2G3CA13_CAPCH) Protein transport protein Sec61 subunit gamma-1 {ECO:0000313|EMBL:PHU15578.1} KW=Complete proteome; Reference proteome OX=80379 OS=Capsicum chinense (Scotch bonnet) (Bonnet pepper). GN=BC332_16783 OC=Capsiceae; Capsicum.
Sequence
MDALDTVFDPLRDFAKDSVRLVKRCHKPDRKEFTKVATRTAIGFVVMGFVGFFVKLIFIP
INNIIVGAS
Download sequence
Identical sequences A0A1U8H433 A0A2G2WL66 A0A2G2ZCN9 A0A2G3CA13 M1CKS0
PGSC0003DMP400047003 NP_001315475.1.44838 XP_006347395.1.80749 XP_015077311.1.21931 XP_016578217.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]