SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G3CWJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G3CWJ0
Domain Number 1 Region: 89-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.7e-16
Family Skp1 dimerisation domain-like 0.00055
Further Details:      
 
Domain Number 2 Region: 15-79
Classification Level Classification E-value
Superfamily POZ domain 0.0000000968
Family BTB/POZ domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G3CWJ0
Sequence length 355
Comment (tr|A0A2G3CWJ0|A0A2G3CWJ0_CAPCH) SKP1-like protein 21 {ECO:0000313|EMBL:PHU23091.1} KW=Complete proteome; Reference proteome OX=80379 OS=Capsicum chinense (Scotch bonnet) (Bonnet pepper). GN=BC332_08198 OC=Capsiceae; Capsicum.
Sequence
MSGGPMAIVKPEMKSYIWLQTADGSIQQVEEEVAMLCPLIYKELTHNGMGSSKNCAILLP
ERVNPANLGLILEFCRFHQVSGRSNKERKKYDEKFVRLDTKMLCDLASAADSLQLRPVVD
LTSRALARIIEGKTPEEIRETFHLPDDLTEEEKLEPLKNITDDPRIRLLNRLYARKRKAL
HKKEKLKNVEVVEEEHRVDERSVDDLLSFINSGDQDSKGVKVTKNKKKSRGRKEQGRNSS
SNSEAGNYNKESNCLTSGTSVGSSPSRNSKLQNSPSELFSSKFDLDDFDIDDELDPARQE
EIDREVEDFARRLNSVWPERIQQILSLGQERKRLGPISMNGNGSLKRCTAGVDRG
Download sequence
Identical sequences A0A2G3CWJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]