SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5B5Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5B5Q2
Domain Number 1 Region: 218-348
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-34
Family cAMP-binding domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 344-469
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-31
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 18-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000251
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5B5Q2
Sequence length 487
Comment (tr|A0A2G5B5Q2|A0A2G5B5Q2_COERN) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} OX=763665 OS=Coemansia reversa (strain ATCC 12441 / NRRL 1564). GN=COEREDRAFT_82838 OC=Kickxellaceae; Coemansia.
Sequence
MDSEKTTISNNRTEHEAEYVEVLAELRDAVFRVRPSDVYQFCASFFDQKLAEQREGLLKI
IDMNPGILDAVPPAAGMGGRGISTGSCSHGASGTPIQPTLSGSGIAQNEEPRESGPEVDS
NHDDQHMSMRHASEHAWSSASAEPAGGMINPNFSFGTKHEDANDMKVDDDTNEEACDKFG
SLVSMPPDGCVQPFVGRRFSVSAESMNPTTEPEYKKKFVPKTEAQKQRIRRALDTNFLFK
NLDEDSYRDVVDAMEEKHVKKGQDVIVQGGVGDYFYIVEHGSFEIFVKKGDGAPSKVSDV
RDGGSFGELALMYNAPRAATVTATSDSTLWALDRITFRSLLMERTSRKRRLYERFLETVP
LLKSLEPYERQKIADALESVTYNDNDTIVKQGDPGSDFFLIEQGSIRVYKTDEDGVTREY
PPLPQGGYFGELALLDDQPRQATLVACGRTKCARMSKDAFDRLLGPVINIIRREAGNYLH
IQSLAKA
Download sequence
Identical sequences A0A2G5B5Q2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]