SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5C520 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5C520
Domain Number 1 Region: 75-150
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.79e-32
Family Skp1 dimerisation domain-like 0.000026
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily POZ domain 6.02e-21
Family BTB/POZ domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5C520
Sequence length 152
Comment (tr|A0A2G5C520|A0A2G5C520_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA25897.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_10400007v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSTKMVTLNSSDGESFDVEEVVITQSQTIKHMIEDDCADNGIPLPNVTAKILAKVIEYCK
KHVEVEGQSTEEEGLKTWDADFVKVDQATLYDLILAANYLNIKSLLDLTCQTVADMIKGK
TPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A2G5C520
Aquca_104_00007.1|PACid:22060315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]