SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5DWP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G5DWP9
Domain Number - Region: 119-161
Classification Level Classification E-value
Superfamily TAZ domain 0.0471
Family TAZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DWP9
Sequence length 185
Comment (tr|A0A2G5DWP9|A0A2G5DWP9_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA47938.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01400499v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MFNLDGDIVVEFDDQVPWLLFVNLLAMFLLIVLVYSSTIFAVDNTNTTSGVVEVDEKSQL
KKFESRSNCSSIIDCEIFSQHTKVNQGPSVTKDNAATTSTTLKRSDRQVVEIQSADKFVI
RDTTRDVTNKIMSSCSYSPCHWLELVSKAFLSCLGLHCSTSQDSTKRKLKNDPSDDLSNN
STGPK
Download sequence
Identical sequences A0A2G5DWP9
Aquca_014_00499.6|PACid:22028889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]