SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5EXV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5EXV0
Domain Number 1 Region: 185-455
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.92e-99
Family Enolase 0.0000000733
Further Details:      
 
Domain Number 2 Region: 47-179
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-50
Family Enolase N-terminal domain-like 0.0000056
Further Details:      
 
Weak hits

Sequence:  A0A2G5EXV0
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5EXV0
Sequence length 460
Comment (tr|A0A2G5EXV0|A0A2G5EXV0_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA60531.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00300193v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSVQEYLDKHMLSRKIEDAVNAAVRAKAPDPVLFISNHMRKAVRCVITKIKARQILDGRG
IPTVEVDLYTNKGMYRAAAPGGTSTGMYGAVELRDGEKGKYIGMGVSRAVKNVNEKISEA
LIGMDPTLQSQIDQAMIDLDKSENKGELGANAILAVSIAACKAGAAEKEVPLYKHIADIS
GKTSAVLPVPAFTLISGGKHAGNNLPAQEIMVLPIGASSFEEAMQMGSEAYQHLKAVISE
RYGAIGCNVGEDGGFSPDISSFTEVLDLVMEAIDRTGYSERIKIAIDVGASDFCIGSKYD
LDFKSPKKSGQNFRTGEDMMELYTQLCRDYPIVSIEEPFDKDDWEHTKSLTRLAICQVVG
DDLLMSNPKCIEKAIDEFTCNALVLKMNQIGTVTEAIEAVKMAKDGHWGVVMSHISGETE
DSFIADLAVGLATGQIKAGAPCRGERLSKYNQGNTCELIN
Download sequence
Identical sequences A0A2G5EXV0
Aquca_003_00193.3|PACid:22049464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]